PTH (1-34), Human
Number: P100001
Name: PTH (1-34), Human
Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
Description: Parathyroid Hormone (PTH) (1-34)
Parathyroid Hormone (PTH) (1-34), Human is a peptide fragment with 34 amino acids of the naturally occurring human parathyroid hormone. PTH is an important regulator for the metabolism of calcium and phosphate. PTH (1-34) (Human) is chemically synthesized and purified by Biopeptek.
< Return to Catalog Peptides